PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_000642-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 84aa    MW: 10037.5 Da    PI: 11.4
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_000642-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox672.4e-211769456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     ++++t++q+e Le+ Fe++++++ +++ +LA++lgL  rqV vWFqNrRa++k
  AHYPO_000642-RA 17 KRRLTTNQIELLENSFEEEKKLDPDRKMKLARELGLHHRQVAVWFQNRRARWK 69
                     4689************************************************9 PP

2HD-ZIP_I/II933.2e-301775361
      HD-ZIP_I/II  3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEk 61
                     krrl+++q++lLE+sFeee+kL+p+rK++lareLgl+ rqvavWFqnrRAR+k+k+l +
  AHYPO_000642-RA 17 KRRLTTNQIELLENSFEEEKKLDPDRKMKLARELGLHHRQVAVWFQNRRARWKAKKLQH 75
                     9*******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.43E-20872IPR009057Homeodomain-like
PROSITE profilePS5007117.4271171IPR001356Homeobox domain
SMARTSM003893.6E-171475IPR001356Homeobox domain
CDDcd000861.92E-121572No hitNo description
PfamPF000461.7E-181769IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-211877IPR009057Homeodomain-like
PRINTSPR000312.9E-64251IPR000047Helix-turn-helix motif
PROSITE patternPS0002704669IPR017970Homeobox, conserved site
PRINTSPR000312.9E-65167IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MRASSCNNSN HEEIKIKRRL TTNQIELLEN SFEEEKKLDP DRKMKLAREL GLHHRQVAVW  60
FQNRRARWKA KKLQHLTTSS NRR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16573ARWKAKKLQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683925.11e-30PREDICTED: putative homeobox-leucine zipper protein ATHB-51
SwissprotQ9LZR01e-26ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLA0A0J8C2552e-30A0A0J8C255_BETVU; Uncharacterized protein
TrEMBLA0A0J8C2N94e-30A0A0J8C2N9_BETVU; Uncharacterized protein
STRINGPGSC0003DMT4000069495e-26(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.16e-28homeobox 51